PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400000027
Common NameLOC102601650
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 225aa    MW: 25881.5 Da    PI: 9.5028
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400000027genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.91.6e-291059251
                          ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          rien++ rqvtfskRrng+lKKA+ELSvLCdaev +iifs++gklye++s
  PGSC0003DMP400000027 10 RIENTTSRQVTFSKRRNGLLKKAFELSVLCDAEVGLIIFSPRGKLYEFAS 59
                          8***********************************************86 PP

2K-box78.81.4e-2682169996
                 K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                           +++ + ++ +qe a L k+ie L++++R+llGe+L+s+sl+e qq+e+qLe+s+++iR++K+++++eq+e+l+++e++l  en++Lr+
  PGSC0003DMP400000027  82 NQSVDIQNNKQETASLMKKIELLESSKRKLLGEGLGSCSLEEVQQIEKQLEQSVTTIRARKMQVFREQMERLKERERALTAENMMLRE 169
                           677889********************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.553161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-32385IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-30323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002654.53E-41375No hitNo description
PfamPF003191.1E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-303859IPR002100Transcription factor, MADS-box
PfamPF014865.6E-2685169IPR002487Transcription factor, K-box
PROSITE profilePS5129715.02787178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000060Biological Processprotein import into nucleus, translocation
GO:0009409Biological Processresponse to cold
GO:0009739Biological Processresponse to gibberellin
GO:0009911Biological Processpositive regulation of flower development
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MVRGKTQMRR IENTTSRQVT FSKRRNGLLK KAFELSVLCD AEVGLIIFSP RGKLYEFASS  60
SVPEVIERYK RHTKDKVQPD VNQSVDIQNN KQETASLMKK IELLESSKRK LLGEGLGSCS  120
LEEVQQIEKQ LEQSVTTIRA RKMQVFREQM ERLKERERAL TAENMMLREL KFGGDEERGK  180
SSGEKEREVV ICIEGGSDKS DVETELFIGQ PHHHDSRIRR PEWS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A9e-19372271Myocyte-specific enhancer factor 2A
3kov_B9e-19372271Myocyte-specific enhancer factor 2A
3kov_I9e-19372271Myocyte-specific enhancer factor 2A
3kov_J9e-19372271Myocyte-specific enhancer factor 2A
3p57_A9e-19372271Myocyte-specific enhancer factor 2A
3p57_B9e-19372271Myocyte-specific enhancer factor 2A
3p57_C9e-19372271Myocyte-specific enhancer factor 2A
3p57_D9e-19372271Myocyte-specific enhancer factor 2A
3p57_I9e-19372271Myocyte-specific enhancer factor 2A
3p57_J9e-19372271Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00076ChIP-chipTransfer from AT2G45660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006339503.11e-163PREDICTED: MADS-box protein SOC1-like isoform X1
RefseqXP_015167027.11e-163PREDICTED: MADS-box protein SOC1-like isoform X1
SwissprotO646452e-82SOC1_ARATH; MADS-box protein SOC1
TrEMBLM0ZFZ91e-163M0ZFZ9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000000281e-163(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.14e-72AGAMOUS-like 20
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]